PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27613.m000642
Common NameLOC8277582, RCOM_0047210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 538aa    MW: 60047.7 Da    PI: 5.5842
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27613.m000642genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS457.67.8e-1401685381374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l+e+L++cA+a++s+d+  +++l+++l++++s +g+p+qRl ay++e+L arla+s+s++y+al+++e +   s+e l+++++++ev+P++kf+++
  27613.m000642 168 LKEVLYACAQAIDSNDMLTVEWLMTELRKMVSVSGEPIQRLGAYMLEGLVARLASSGSSIYRALRCKEPA---SAELLSYMHILYEVCPYFKFGYM 260
                    5789*****************************************************************9...9********************** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aI ea++ e+rvHiiDf+i qG QW++L+qaLa+Rp+gpp++R+Tg+++++s   +   l  +g+rL+++Ae+++vpfef++ +  + +++e
  27613.m000642 261 SANGAIAEAMKDESRVHIIDFQIAQGSQWITLIQALAARPGGPPHVRLTGIDDSTSAyaRGGGLDIVGQRLSRLAESCKVPFEFHA-AGVSGSEIE 355
                    *****************************************************998899999************************.8999***** PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    l++L ++pgEala+n++l+lh+++desv ++++rd++L+lvkslsPkvv++veqe+++n+++F++rf+e+l+yy a+f+s++++lpr ++eri+vE
  27613.m000642 356 LKNLGIRPGEALAINFALMLHHMPDESVGTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAPFVNRFTETLNYYLAIFESIDVTLPRGHKERINVE 451
                    ************************************************************************************************ PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++l+re+vn+vacegaer+erhe l+kW++r+ +aGF+p+pls+++++++k+ll+ ++++ y++ee++g+l+lgW++rpL++ +aWr
  27613.m000642 452 QHCLAREVVNIVACEGAERIERHEPLGKWKSRFAMAGFTPYPLSSFVNATIKALLQSYSKK-YTLEERDGALYLGWMNRPLIASCAWR 538
                    ***********************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.105142519IPR005202Transcription factor GRAS
PfamPF035142.7E-137168538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MQTSQKGTVM DGPPGFYDHP VRPRESYHWH SNQNLDQYPM SDDGSQEMHL SAETFDQHST  60
LESSSGTGGY PVQTSPSTAS FSPNESVISQ PNSQSYILDQ HDSSENTSGS PDREAYVIHK  120
LRELETAMLG PADDLDVYNI MTQDGSNQIT SEEEKWKFLM ETVSRRDLKE VLYACAQAID  180
SNDMLTVEWL MTELRKMVSV SGEPIQRLGA YMLEGLVARL ASSGSSIYRA LRCKEPASAE  240
LLSYMHILYE VCPYFKFGYM SANGAIAEAM KDESRVHIID FQIAQGSQWI TLIQALAARP  300
GGPPHVRLTG IDDSTSAYAR GGGLDIVGQR LSRLAESCKV PFEFHAAGVS GSEIELKNLG  360
IRPGEALAIN FALMLHHMPD ESVGTQNHRD RLLRLVKSLS PKVVTLVEQE SNTNTAPFVN  420
RFTETLNYYL AIFESIDVTL PRGHKERINV EQHCLAREVV NIVACEGAER IERHEPLGKW  480
KSRFAMAGFT PYPLSSFVNA TIKALLQSYS KKYTLEERDG ALYLGWMNRP LIASCAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-631725388375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580779.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_002529051.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015580778.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLB9SST20.0B9SST2_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGPOPTR_0001s37270.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5